Disclaimer: By viewing this personal website, you understand that all interests, expressed or implied, on the following web pages are intended to represent only those of Dr. Larry Wayne Lewis. Website Last Revised: January 18, 2016.
http://www.drlarrywaynelewis.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.5 seconds
16x16
32x32
64x64
128x128
160x160
192x192
PAGES IN
THIS WEBSITE
6
SSL
EXTERNAL LINKS
0
SITE IP
185.176.43.59
LOAD TIME
0.53 sec
SCORE
6.2
drlarrywaynelewis.com | drlarrywaynelewis.com Reviews
https://drlarrywaynelewis.com
Disclaimer: By viewing this personal website, you understand that all interests, expressed or implied, on the following web pages are intended to represent only those of Dr. Larry Wayne Lewis. Website Last Revised: January 18, 2016.
drlarrywaynelewis.com
drlarrywaynelewis.com
http://www.drlarrywaynelewis.com/about.html
Dr Lewis' primary research interests focus on fuzzy set theory and statistics, both applied and theoretical. His other affections incorporate Bible study, active membership and involvement at St. Stephen Missionary Baptist Church (Louisville, Kentucky), music, travelling, and following various sports teams, especially University of Louisville men's basketball. Smooky (pictured above) is Dr. Lewis' cat. Dr Lewis (above) presenting and moderating at the 2014 Joint Mathematics Meetings,.
drlarrywaynelewis.com
http://www.drlarrywaynelewis.com/resources.html
Sports Illustrated AP Poll. Interactive Display of Statistical Distributions. Various online calculators (for algebra, geometry, and statistics). Interactive Spinner (to illustrate probabilities). Blackboard Learn 9.1. Ivy Tech Email (direct link). Ivy Tech Campus Connect.
drlarrywaynelewis.com
http://www.drlarrywaynelewis.com/church.html
Lookup a word or passage in the Bible. Verse of the Day:. Dr Lewis is an active member of the. St Stephen Missionary Baptist Church, Louisville, Kentucky. Rev Dr. Kevin Wayne Cosby, Senior Pastor (pictured above). Other recommended churches that Dr. Lewis has visited:. Eastern Star Church, Pastor Jeffrey A. Johnson, Sr., Indianapolis, Indiana. Friendship-West Baptist Church, Rev. Dr. Frederick D. Haynes, III, Dallas, Texas. Mount Zion Baptist Church, Rev. Aaron Williams, Seattle, Washington.
drlarrywaynelewis.com
http://www.drlarrywaynelewis.com/personal.html
Dr Lewis' personal interests include the following:. University of Louisville Men's Basketball. Indiana University Men's Basketball. Birmingham Civil Rights Institute, Birmingham, Alabama. National Civil Rights Museum, Memphis, Tennessee. Friend For Life Cancer Support Network, Louisville, Kentucky. Carver Community Organization, Evansville, Indiana. National Underground Railroad Freedom Center, Cincinnati, Ohio. The King Center, Atlanta, Georgia.
drlarrywaynelewis.com
http://www.drlarrywaynelewis.com/scholarship.html
Dr Lewis is an adjunct professor (gratis appointment) at:. University of Louisville School of Public Health and Information Sciences, Louisville, Kentucky. Probability and Statistics courses (Graduate level). From fall, 1976, to the present, Dr. Lewis has taught at the following colleges and universities:. Previous full time teaching:. Ivy Tech Community College Southern Indiana, Sellersburg, Indiana. Mid-Continent University, Mayfield, Kentucky (online and remote satellite locations). Association of Chr...
TOTAL PAGES IN THIS WEBSITE
6
General Surgery Panama City, FL - Larry T. Wong D.O., P.A.
Panama City, FL General Surgery. Larry T. Wong D.O., P.A. For colon, rectal or general surgery needs, call Larry T. Wong D.O., P.A. of Panama City, FL. Dr Larry T. Wong D.O., P.A. is a fully licensed and insured surgeon that specializes in general surgery discipline. Our clinic assures our patients that their safety comes first before anything else. Our clinic specializes in:. We also accept insurance from:. Blue cross and Blue shield – BlueCard PPO. Cigna – Open access. Fully licensed and insured.
hibu
This site was purchased through our premier business store. Check it out today! Hibu is here to help consumers find local businesses, browse products. And services and buy locally. With a broad range of digital services on offer, hibu can help small. Businesses compete in the online world in next to no time at all. Together, we can help communities thrive. Discover solutions that are easy. To use and knowledge to help your business thrive. Try our products for free. Promote your business today.
Dr. Larry U Bussanmas | Clovis, NM 88101 | DexKnows.com™
Dr Larry U Bussanmas. 3728 N Prince St. Dr Larry U. Bussanmas has been serving the Clovis, NM, area for more than 25 years. His practice includes eye care for the entire family. He prescribes glasses as well as contact lenses and performs fittings, adjustments and repairs on eyeglass frames. Come to Dr. Bussanmas's office for:. 8226; Eye exams. 8226; Contact lenses. We have a full selection of stylish frames for glasses and sunglasses. No…. Come to Dr. Bussanmas's office for:. 8226; Eye exams.
The Sacred Dance by Larry Wampler, Ph.D.
An indispensable guide to the spiritual opportunities of married life. Intriguing examples show how the trials of love can lead beyond romantic illusions, to divine love. Robert Johnson, Author of. We: Understanding the Psychology of Romantic Love. Free shipping on five or more copies to. The same address. That's a savings of $8. ($20 if ordered separately.). Fulfill the Spiritual Potential. Have you ever longed for something more in marriage? Will help you . Turn conflicts into spiritual opportunities.
Therapist | Arlington TX | Dr. Larry Watson
Arlington is the home of our practice, and we serve people from throughout the DFW Metroplex and beyond. Call Now (972) 740-5422. While it may not be easy to seek help from a mental health professional, it is hoped that through therapy you will change in the following ways. Gain greater insight into your situation and feelings. Develop expanded conceptualizations of your life, relationships, circumstances, and future. Move toward resolving your concerns. As your therapist,.
drlarrywaynelewis.com
Disclaimer: By viewing this personal website, you understand that all interests, expressed or implied, on the following web pages are intended to represent only those of Dr. Larry Wayne Lewis. Website Last Revised: January 18, 2016.
LARRY WEBB REAL ESTATE Homepage | Larry Webb
Larry Webb, Ph.D., MBA. Larry Webb, Ph.D., MBA. Ladera Ranch Community Info. Neighborhood - School Information. Find a Home in Your Area:. Larry Webb, Ph.D., MBA. Real Estate Agent - Broker Associate - REALTOR. Owner: Webb Real Estate and Property. Management, Inc. CalBRE: 01994395. Orange County, California. CA Notary Public # 2042498. I hope you enjoyed my Spokesmodel's video introduction of my experience, education, and passion for exceptional customer service. For my PERSONAL VIDEO. 160; . Neighborh...
drlarryweiner.com - Registered at Namecheap.com
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.
New Jersery, Plastic Surgeon, Dr. Larry P. Weinstein Chief Plastic Surgery Morristown Memorial
Dr Weinstein looks forward to helping you. Please contact us with any questions or comments you may have. Please call our office at 908 879 2222 or use the contact form below. Email is not in correct format. Phone or Email Required. You must be a bot. Do not fill this textbox. Unable to submit - Please Try Again. Your message has been sent. We will contact you shortly if your message requires a response. Please contact us via telephone or email below. Please follow Dr. Weinstein on his blog. Call (908) 8...
drlarrywfranklinphdvipservice.com
Dr. Larry Franklins Vip Services
Dr Larry Franklin Sr. has worked with America and Bermuda's youth and adults for 30 years. During this time he has offered direct support to 10-40 year old youth and adults. He helps them to identify and achieve their goals in life and acts as a guide in the development of these individuals. Hope Beyond the Streets originated by Dr. Franklin and is managed exclusively by him. Programming for Hope Beyond the Streets:. Sessions occur on a weekly basis. 3 During the first session an informal assessment is c...
Dr Larry Williams
Welcome to Dr Larry Williams. Welcome to our website! We look forward to the opportunity to serve you and your family with competence and professionalism. Conveniently located in the Buckhannon Eye Center. This premier eye care facility is conveniently located adjacent to St Joseph’s Hospital in Buckhannon, West Virginia. Dr Williams is experienced and dedicated to excellence. We look forward to meeting you! Call our office today for an appointment! We look forward to taking care of your precious eyes!
