Child & Family Service (CFS) of Hawaii is a private, nonprofit founded in 1899. Dedicated to the mission of strengthening families and fostering the healthy development of children for more than 113 years, CFS provides 30-plus programs throughout the islands and touches the lives of children, youth, families, seniors, and their caregivers.
http://www.childandfamilyservice.org/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
2.7 seconds
16x16
Child & Family Service
Child & Family Service
91-1841 ●●●●●●●●ver Road
Ewa●●●ach , HI, 96706
US
View this contact
Child & Family Service
Child & Family Service
91-1841 ●●●●●●●●ver Road
Ewa●●●ach , HI, 96706
US
View this contact
Network ** Engineering
520 SW 6t●●●●●●●●●Suite 300
Por●●●and , OR, 97204
US
View this contact
BUY YOUR DOMAIN
Network Solutions, LLC (R63-LROR)
WHOIS : whois.publicinterestregistry.net
REFERRED :
PAGES IN
THIS WEBSITE
3
SSL
EXTERNAL LINKS
21
SITE IP
70.32.78.213
LOAD TIME
2.706 sec
SCORE
6.2
Child & Family Service | Our Impact on the Families of Hawaii | childandfamilyservice.org Reviews
https://childandfamilyservice.org
Child & Family Service (CFS) of Hawaii is a private, nonprofit founded in 1899. Dedicated to the mission of strengthening families and fostering the healthy development of children for more than 113 years, CFS provides 30-plus programs throughout the islands and touches the lives of children, youth, families, seniors, and their caregivers.
childandfamilyservice.org
Child & Family Service | Volunteer
https://www.childandfamilyservice.org/volunteer.html
FAQ & Resources. FAQ & Resources. FAQ & Resources. FAQ & Resources. AFP Code of Ethical Principles and Standards. We appreciate your interest in volunteering at Child and Family Service. Child and Family Service is a complex organization which serves a wide variety of clients in a myriad of locations. We currently have nearly 50 programs. Regular and Ongoing Volunteers:. Providing assistance with client services or ongoing administrative support to programs, handling confidential client information. ...
Child & Family Service | “Intentions” by Kealoha
https://www.childandfamilyservice.org/kealoha.html
FAQ & Resources. FAQ & Resources. FAQ & Resources. FAQ & Resources. NEW* A Safe Place: Neighborhood Place of Wailuku Video. Board Chair and Ka Pa Ola Girls:. Full Circle: From Program Participant to Professional Staff. A Donor's Story: From Violence to a Better Life. A Board Leader's Experience. My Story - Hale O Ulu. Partners with Hawai‘i Families. A Heartfelt Letter from a Mother. IRC Helps Family Adjust to a New Way of Life. Child and Family Service: “Intentions” by Kealoha. From Banzai Media, LLC.
Child & Family Service | In-Kind Donations
https://www.childandfamilyservice.org/inkind.html
FAQ & Resources. FAQ & Resources. FAQ & Resources. FAQ & Resources. Child and Family Service appreciates gifts-in-kind, donations of items and services, which help various programs. Due to storage issues, please call 808.543.8413. If you are interested in donating. Walk-in donations will not be accepted. CHILD and FAMILY SERVICE TOP WISH LIST. We welcome donations of new items listed or gifts of cash/checks in any amount which can be used to help purchase these items and other pressing needs. Gift Cards ...
TOTAL PAGES IN THIS WEBSITE
3
Resources
http://hscadv.org/resources
CALL US: 808.832.9316. The Hawaii State Coalition Against Domestic Violence is comprised of at least 20 domestic violence agencies and programs throughout the state of Hawaii,which accounts for the majority of domestic violence agencies and programs in the state.Below you will find a list of the agencies and programs, with their contact information and program descriptions. Feel free to contact the agencies and/or programs directly should you require their services. Hale ‘Ohana Shelter – East Hawaii.
Anger Management Training - Hawaii
http://www.angerbuster.biz/sitemap.html
Honolulu, Maui, Kauai, Lanai. Ldquo;Change your thoughts. And you change the world”. Ldquo;A good conscience is. A continual Christmas.”. Domestic Volence – Hawaii. Anger Management Class - Anger Management Training. Anger Management Course Hawaii. Jim Bakar, Chairman and CEO. Domestic Violence - Hawaii. Online Certified Anger Resolution Therapist Training - Hawaii. Child and Family Services. 91-1841 Ft. Weaver Rd. Ewa Beach, Hawaii 96706. Health Related Web Sites in Hawaii and the Pacific. The largest a...
Links - Hartley & McGehee Family Law
http://hmfamilylaw.com/links
Call Us: (808) 263-6900. 40 Aulike Street, Suite 314, Kailua Directions. Kailua Professional Center II. 40 Aulike Street, Suite 314. Kailua, Hawaii 96734. Bill McRoberts, Financial Planning. Curtis Yuen, Estate Planning. Kimo Todd, Financial Planning. Scott Suzuki, Estate Planning. Child and Family Services. Child Support Enforcement Agency. Defense Finance and Account Service. Domestic Violence Action Center. Educated Divorce: A Low Cost Interdisciplinary Approach. Hawaii Child Support Guidelines.
Executive Office on Early Learning | For Parents & Families
http://earlylearning.hawaii.gov/standards/what-parents-need-to-know
Office of the Governor. Executive Office on Early Learning. 2014 Focus Area Meeting Dates. Focus Areas and Objectives. NGA Policy Academy: Formative Child Assessments. Importance of Early Learning. Hawaii Early Learning and Development Standards (HELDS). Hawaii Family Partnership Guidelines (FPG) for Early Childhood Settings. For Parents & Families. Resources for Providers and Educators. Early Learning Advisory Board. For Parents & Families. For Parents & Families. View the preschool density map. Part-da...
Maui Theatre, Home of ʻUlalena and Burn'n Love | Maui Shows and Things to Do
http://www.mauitheatre.com/blog
Magic on Maui featuring America's Got Talent's Seth Grabel. For a limited time only starting June 18, 2016! Talk Story - Meet the Cast and Crew of ʻUlalena. Get to know our talented, dedicated cast and crew. ʻUlalena Specials and Promotions. Maui Theatre Events and Information. ʻUlalena Lyrics and Translations. Find the lyrics and translations to the ʻUlalena soundtrack! America’s Got Talent star Seth Grabel brings his world-famous magic to Maui. June 11, 2016. Ulalena at Maui Theatre. Grabel is best kno...
Resources
http://www.lokahitreatmentcenters.net/resources2.html
At Lokahi Treatment Centers, we believe in strength-based and client centered treatment supported by linkages and referrals to other community-based resources and agencies for continued recovery. Learn more about available resources available throughout the. State of Hawai'i by clicking the links below. Note: Not all listed resources have websites. LTC will update links as websites become available. 24-Hour Crisis Line of Hawai'i. Adult Mental Health Division Eligibility Line. Aloha United Way 2-1-1.
Hawaii Island United Way | Community Partners
http://hiuw.org/partneragencies
Board of Directors 2015 2016. Board of Directors 2014 2015. Board of Director Downloads. Disaster Relief and Recovery. Business Services Hawaii HI5 Fundraiser. Hawaii State AFL-CIO Labor’s Community Services Program. Kākoʻo I Nā Keiki. FamilyWize Prescription Discount Card. An Evening in Paradise. 23rd Annual Mayor’s Cup Invitational Golf Tournament. 4th Annual Hawai‘i Island Senior Softball Mayor’s Cup. Aloha Council, Boy Scouts of America. Aloha Independent Living Hawaii. The Arc of Hilo. West Hawaii M...
HI VOAD Membership | CommunityOS
http://hivoad.communityos.org/cms/membership
Agency and Staff Login:. Is open to any organization that has a role to play in helping communities in Hawaii prepare for, respond to, and recover from disasters. Nonprofits, faith-based, community, and private-sector organizations may all become full voting members. Government agencies may become non-voting partners. Annual membership dues are $50. Members wishing to get in touch with fellow VOAD member organizations can access the Contact Roster. American Radio Relay League. Child and Family Service.
TOTAL LINKS TO THIS WEBSITE
21
childandfamilyresourcecenter.com
Child and Family Resource Center
Child & Family RI | Home
Programs & Services. Adults & Families. Volunteer & Intern. Sponsor & Partner Opportunities. News & Media. At Child and Family we hold two core beliefs; that individuals and communities thrive. When supported by strong families. And that a community works best when it is willing to accept responsibility. For all of its members. 2017 Child and Family. A Private 501(c)3 Non-Profit. SERVING THE COMMUNITY SINCE 1866. Call today or complete our online form. For questions and appointments.
childandfamilysaginaw.com
Welcome to: childandfamilysaginaw.com. This Web page is parked for FREE, courtesy of GoDaddy.com. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.
Child & Family Services of Saginaw
Child and Family Services of Saginaw. News & Resources. Achieve emotional health with the help of an expert therapist. Employee assistance programs are flexible to accommodate any type of organization. We help survivors heal from the trauma of sexual violence. About Child and Family Services. Child and Family Services of Saginaw is dedicated to enhancing the quality of life in our community by fostering personal growth, emotional development, recovery from trauma, self-reliance, and healthy relationships.
ChildAndFamilyService.com is for Sale! @ DomainMarket.com, Maximize Your Brand Recognition with a Premium Domain
Ask About Special March Deals! What Are the Advantages of a Super Premium .Com Domain? 1 in Premium Domains. 300,000 of the World's Best .Com Domains. Available For Immediate Purchase. Safe and Secure Transactions. 24/7 Customer Support: 888-694-6735. Search For a Premium Domain. Or Click Here To Get Your Own Domains Appraised. Find more domains similar to ChildAndFamilyService.com. We are constantly expanding our inventory to give you the best domains available for purchase! 4,295,648,149. That would be...
Child & Family Service | Our Impact on the Families of Hawaii
News & Events. Bank of Hawaii presents HEROES & LEGENDS. LEADERSHIP CUP Golf Tournament. Resources & FAQ. Resources & FAQ. LEADERSHIP CUP Golf Tournament. Trauma resources for you and your keiki. Our Impact on the. Child and Family Service. Our Organization in Numbers. Number of years CFS has. Been serving the community. That stay in Hawai‘i. When Family Comes Together. CFS Hilo Center Gives Single Mother Fresh Start. Emma’s 9-year-old son came up with a code word: FM. It stood for Forward Movement&#...
Child and Family Day care, quality in home child day care in Wyong
Our Programs and Services. Our Programs and Services. Website language translator, please select your language. Powered by : ak. Your email address is currently not registered,. Please contact admin@wyongfdc.asn.au or 02 4352 5252. You do not have access to this page. For access please contact admin@wyongfdc.asn.au or 02 4352 5252. Register email address [ Click here ]. Your password will be sent to your email shortly.
Bienvenue sur childandfamilyservices.org
Bienvenue sur childandfamilyservices.org. Ce site est actuellement en construction. N'hésitez pas à venir le visiter prochainement! Jai choisi un hébergeur Web écologique et socialement responsable.
childandfamilyservicesphilippines.blogspot.com
Child and Family Service Philippines
Child and Family Service Philippines. Tuesday, August 3, 2010. Child and Family Services Philippines. Children, women and families in need of special protection (victims of abuse and neglect, children-in-conflict with the law (CICL), children in the labor-force, street children, out-of-school-youth). Families experiencing social dysfunction (victims of domestic violence, high-risk parents). Sectors of the community such as students, interns, volunteers, socio-civic groups, church groups, schools, etc.
www.childandfamilysolutions.com
This Web page parked FREE courtesy of Domains Priced Right. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $4.99/mo. Call us any time day or night (480) 624-2500.
Home - Child and Family Solutions
Information for Foster Parents. Child and Family Solutions. Child and Family Solutions was developed by Orla Ryan in early 2012, in order. To provide a specialist service for children, separating families, foster families,. Adoptive families and professionals who face challenges in their work with children. The key components of the service offered by Child and Family Solutions,. Are Guardian ad Litem services, consultation and assessment services, which have.
SOCIAL ENGAGEMENT