CONTENT
TRAFFIC INFO
REVIEWS
COUPONS
SERVER
WEB RESULTS
Page Analysis
milspecdepot.com
milspecdepot.com
No description found
No description found
http://www.milspecdepot.com/
Daily Ad Revenue: ~n/a
Estimated Revenue: ~n/a
Links: 0
Speed: ( seconds) % of sites are slower.
Online Since: n/a
Web page information
- Titlemilspecdepot.com
- Keywords hit in search results $sold adding
aluminumamazonanodizecalgunscarrier changes check coated combat compare coupons customer cylinder depot design editedenforcemententhusiastsequipmentexperiencefinishgoods guide huntingindustriesintroduceslevellinkedinmatchmilitarymilspecdepot milspecdepotllcmountnationalnitrideonlineother outdoor pardonpersonalpistons platform please police postspremiumpresident prices professional profile ratings reason records replacing reputation resellerratingsretailerreviews rolloutruffaloruffworld sadlak sauerscopeshipping shipsshootingspecializingsporting sports spring stock stores tacticalthreadthreads titanium training trigger vendors while world - Search Engine Recommended KeywordsMil Gear, Mill Spec, Casio Tactical, Home Depot 90012, Mil-Spec Radio Gear, Mill Spec Industries LLC, Sig Sauer P229 SRT Trigger, G-Shock Tactical Police Watch,
DMOZ Directory Information
- Directory Title:No Title Found
- Directory Description:No Description Found
- Keywords:No Keywords Specified.
- Categories:No dmoz categories found.
www.MilSpecDepot.com - Mil Spec Depot | Premium Gear | Tactical ...
Mil Spec Depot is an online retailer specializing in tactical equipment for military/law enforcement personal and tactical shooting enthusiasts.
Check the reputation of Milspecdepot.com. Read real customer reviews. Compare prices to other stores and find coupons.
Calguns.net > Vendors: Mil Spec Depot ... New posts: Hot thread with new posts: No new posts: Hot thread with no new posts
Please pardon our mess while we rollout some new design changes to the MilSpecDepot.com site.
Last edited by milspecdepot; 01-24-2012 at 6:11 AM. Reason: Add ... may not post new threads
Mil Spec Depot introduces the SIRT AR-Bolt. Next Level Training is adding a new training tool for the AR-15 platform, the SIRT-AR Bolt. By replacing your bolt carrier ...
Mil Spec Depot is an online retailer specializing in tactical equipment for military/law enforcement personal and tactical shooting enthusiasts.
Sadlak M 1 A Scope Mount Aluminum hard-coat anodize finish MIL SPEC DEPOT! in Sporting Goods, Outdoor Sports, Hunting | eBay
View Joe Ruffalo's professional profile on LinkedIn. Experience: Vice President, Ruffworld Records.
Ships from and sold by Mil Spec Depot. Free shipping. Sadlak Industries M14 National Match Gas Cylinder Pistons, Titanium Nitride Coated by N/A. In Stock.
Mil Spec Depot is an online retailer specializing in tactical equipment for military/law enforcement personal and tactical shooting enthusiasts.
http://www.milspecdepot.com/info.html
Milspecdepot.com Reviews - milspecdepot.com Ratings at ResellerRatingsCheck the reputation of Milspecdepot.com. Read real customer reviews. Compare prices to other stores and find coupons.
http://www.resellerratings.com/store/Milspecdepot_com
Mil Spec Depot - Calguns.netCalguns.net > Vendors: Mil Spec Depot ... New posts: Hot thread with new posts: No new posts: Hot thread with no new posts
http://www.calguns.net/calgunforum/forumdisplay.php?f=236
Tactical Police Gear ReviewsPlease pardon our mess while we rollout some new design changes to the MilSpecDepot.com site.
http://site.milspecdepot.com/
SOLD SOLD WTS Sig Sauer P220 Combat SRT Trigger $SOLD SOLD ...Last edited by milspecdepot; 01-24-2012 at 6:11 AM. Reason: Add ... may not post new threads
http://www.calguns.net/calgunforum/showthread.php?t=521312&goto=newpost
Next Level Training - Mil Spec Depot | Premium Gear | Tactical Kit ...Mil Spec Depot introduces the SIRT AR-Bolt. Next Level Training is adding a new training tool for the AR-15 platform, the SIRT-AR Bolt. By replacing your bolt carrier ...
http://www.milspecdepot.com/sirtarbolt.html
eBay My World - milspecdepotllcMil Spec Depot is an online retailer specializing in tactical equipment for military/law enforcement personal and tactical shooting enthusiasts.
http://myworld.ebay.com/milspecdepotllc/
Sadlak M 1 A Scope Mount Aluminum hard-coat anodize finish MIL ...Sadlak M 1 A Scope Mount Aluminum hard-coat anodize finish MIL SPEC DEPOT! in Sporting Goods, Outdoor Sports, Hunting | eBay
http://www.ebay.com/itm/Sadlak-M-1-A-Scope-Mount-Aluminum-hard-coat-anodize-finish-MIL-SPEC-DEPOT-/290706131962
Joe Ruffalo | LinkedInView Joe Ruffalo's professional profile on LinkedIn. Experience: Vice President, Ruffworld Records.
http://www.linkedin.com/pub/joe-ruffalo/38/32/421
Amazon.com: Sadlak Industries M14 National Match Spring Guide ...Ships from and sold by Mil Spec Depot. Free shipping. Sadlak Industries M14 National Match Gas Cylinder Pistons, Titanium Nitride Coated by N/A. In Stock.
http://www.amazon.com/Sadlak-Industries-National-Match-Spring/dp/B003MA1SSI
No Coupons found for this website.
| IP Address: | 0.0.0.0 |
| Location: | , , |
| Zip Code: | |
| Geo Location: | 0, 0 |
| Server: | |
| Powered By: | |
| ASP.net version: | |
| DNS Servers | |
WHOIS Information:
Domain Info:
- Domain was Created:
- Domain Expires:
- Domain was last Updated:
| Alexa Rank | Compete Rank / Count | Quantcast Rank | Google PageRank |
|---|---|---|---|
| 9,767,132 | ~ / ~ | ~ |
| Traffic Rank | % of Internet Users | Reach Rank | |
|---|---|---|---|
| Past 1 day: | ~ | ~ | ~ |
| Past 7 days: | 4,775,147 | 0.00004% | 4,775,147 |
| Past 1 month: | 11,784,160 | 0.000008% | 11,784,160 |
| Past 3 months: | 9,767,132 | 0.000008% | 9,767,132 |
| PageViews Rank | % of Internet PageViews | Page Views Per User | |
| Past 1 day: | ~ | ~ | ~ |
| Past 7 days: | 4,990,252 | ~ | 1 |
| Past 1 month: | 12,191,175 | ~ | 1 |
| Past 3 months: | 9,905,808 | ~ | 2 |
Site Disclaimer:
All trademarks are the property of their respective owners. The facts, figures, reviews, records, stats, and other data presented on this page is for suggestion and information purposes only. RankSphere.com is not responsible for any incorrect or incomplete information. RankSphere.com does not take responsibility for any user-reviews of websites inside its resource and reserves the right to keep or remove those. It is highly recommended that you review all the data for accuracy.
All trademarks are the property of their respective owners. The facts, figures, reviews, records, stats, and other data presented on this page is for suggestion and information purposes only. RankSphere.com is not responsible for any incorrect or incomplete information. RankSphere.com does not take responsibility for any user-reviews of websites inside its resource and reserves the right to keep or remove those. It is highly recommended that you review all the data for accuracy.